ll-37 peptide for sale

ll-37 peptide for sale

: Premium LL-37 Peptide for Sale – Direct from Shanghai Manufacturer**

The innate immune system relies on a fascinating class of molecules called antimicrobial peptides. Among these, LL-37 stands alone—it is the only cathelicidin-derived antimicrobial peptide found in humans. If you are searching for “LL-37 peptide for sale,” you need a manufacturing partner who understands the complexity of this host defense peptide and can deliver the purity your research demands. That partner is Apeptide (Shanghai) Co., Ltd.
We are a legitimate, licensed manufacturer operating from our headquarters at No. B Room 326, Jinhai Road 2588, Pudong District, Shanghai, China. Our facility is dedicated to the research, development, and production of high-purity peptide raw materials, including LL-37 and related biochemicals. When you purchase LL-37 peptide for sale from [shanghaiapeptides.com](https://shanghaiapeptides.com), you are buying directly from the source—not a middleman or reseller.
 Understanding LL-37: The Human Cathelicidin
LL-37 is a 37-amino acid peptide cleaved from the C-terminal end of the human cathelicidin protein, hCAP18. It is the sole member of the cathelicidin family expressed in humans and plays a multifaceted role in immune defense and cellular regulation.
Why LL-37 Matters in Research
– Antimicrobial Activity LL-37 disrupts bacterial membranes, making it valuable for studying host-pathogen interactions.
– Immunomodulation It influences cytokine release, chemotaxis, and inflammation.
-Wound Healing Research suggests LL-37 promotes angiogenesis and tissue repair.
– Cancer Biology: Investigated for its effects on tumor cells and the tumor microenvironment.
 Molecular Characteristics
– Sequence  [LL-37, 37 aa]
– Molecular Weight Approximately 4.5 kDa
– Structure: Amphipathic alpha-helical peptide
– CAS Number: 2023788-19-2 (for reference)
 The Critical Importance of Quality for LL-37
LL-37 is a challenging peptide to synthesize. Its length, hydrophobicity, and tendency to form secondary structures require advanced manufacturing expertise. Low-quality LL-37 may be truncated, misfolded, or contaminated—all of which invalidate research. https://shanghaiapeptides.com/
 The Apeptide Quality Standard
– 99% Purity Guarantee Verified by HPLC and Mass Spectrometry.
-Proper Folding Ensuring correct amphipathic helix formation.
– Batch-Specific COAs: Full traceability with Certificates of Analysis.
– Stability Testing: Maintaining integrity from our lab to yours.
-Endotoxin Testing: Available for cell culture applications.
 Our LL-37 and Related Product Portfolio
Apeptide (Shanghai) Co., Ltd. manufactures high-purity LL-37 alongside a comprehensive range of research peptides and biochemicals.
LL-37 Offerings
– LL-37 (Full Length): The complete 37-amino acid human cathelicidin peptide.
– LL-37 Fragments: Shorter sequences for structure-activity relationship studies.
– Labeled LL-37: Fluorescently tagged versions for imaging and binding assays.
 Complementary Research Products
-Other Antimicrobial Peptides: Including defensins and magainins.
– Innate Immunity Reagents: Cytokines and related factors.
– Catalog Peptides:Hundreds of research-grade sequences ready for immediate shipment.
– Fluorescent Dyes & Amino Acids: For custom labeling and synthesis needs.
The Manufacturer Advantage: Why Source LL-37 from Apeptide
When you search for “LL-37 peptide for sale,” you encounter many options. Here is why direct sourcing from our Shanghai facility is the superior choice.
 Complete Transparency
– Physical Location:We operate from No. B Room 326, Jinhai Road 2588, Pudong District, Shanghai. You can verify our credentials.
– Manufacturing Expertise: Decades of combined experience in peptide synthesis and biochemical production.
– No Middlemen:You pay manufacturer-direct pricing, not reseller markups.
 Technical Expertise
LL-37 is not a simple peptide. Our team understands:
– The challenges of synthesizing amphipathic helices.
– Proper handling to prevent aggregation.
– Appropriate reconstitution buffers for your applications.
– Assay considerations for antimicrobial research.
 Quality You Can Trust
– Rigorous Testing: Every batch undergoes HPLC and MS analysis.
– Documentation: Full COAs provided for complete traceability.
– Consistency:Reliable quality batch after batch. ll-37 peptide for sale
Seamless Supply to the USA Market
Sourcing LL-37 peptide for sale from China should be straightforward. We have optimized our logistics specifically for American researchers and wholesale partners.
– Fast Shipping: 5-7 business days to US addresses.
– Cold-Chain Packaging:Temperature-controlled transit for sensitive peptides.
– Wholesale Programs: Dedicated support for small and large supply companies.
– Customs Expertise: Smooth clearance with complete documentation.
– Discreet Packaging: Professional, temperature-controlled containers.
Research Applications: Where LL-37 Shines
Understanding the diverse applications of LL-37 helps researchers appreciate why quality matters.
 Infection and Immunity
– Bacterial killing assays
– Biofilm disruption studies
– Immune cell chemotaxis
– Cytokine modulation
 Inflammation and Disease
– Inflammatory bowel disease models
– Psoriasis and skin inflammation
– Rheumatoid arthritis research
– Chronic wound investigations
 Cancer Research
– Tumor cell cytotoxicity
– Immune surveillance mechanisms
– Microenvironment interactions
Wound Healing and Tissue Repair
– Angiogenesis assays
– Keratinocyte migration
– Fibroblast proliferation
Frequently Asked Questions
Q: Are your LL-37 peptide for sale products approved for human use?
A: No. Apeptide (Shanghai) Co., Ltd. supplies products strictly for research and development purposes. They are not for human consumption, clinical application, or any use involving humans or animals. This distinction is critical for compliance.  ll-37 peptide for sale
Q: How do I verify the purity of your LL-37?
A: We provide a Certificate of Analysis (COA) via HPLC and Mass Spectrometry testing for every batch. You can request this before or after purchase through our website. ll-37 peptide for sale
Q: Do you ship to all 50 US states?
A: Yes. We ship to research institutions, laboratories, and wholesale partners throughout the United States.
Q: Can you accommodate bulk orders for wholesale distribution?
A: Absolutely. We offer competitive wholesale pricing for qualified partners. Contact our team through [shanghaiapeptides.com](https://shanghaiapeptides.com) with your volume requirements. ll-37 peptide for sale
Q: How should I store LL-37 upon receipt?
A: LL-37 should be stored at -20°C (freezer) immediately upon receipt, protected from light and moisture. Lyophilized powder is stable when stored properly. Avoid repeated freeze-thaw cycles. Reconstitute in appropriate buffers—LL-37 can aggregate in plain water.
Q: What buffer should I use for reconstitution?
A: For most applications, we recommend sterile phosphate-buffered saline (PBS) or 0.1% acetic acid. Avoid low-ionic-strength solutions which can promote aggregation. Contact our technical team for application-specific recommendations.
Q: Do you test for endotoxins?
A: Yes, endotoxin testing is available upon request, particularly for cell culture applications. Please specify your requirements when ordering.
 Quality Control: The Apeptide Standard
Your research deserves nothing less than the highest purity materials. Our quality control protocols exceed industry standards.
– HPLC Analysis:Every batch tested for purity (typically 99%+).
-Mass Spectrometry: Molecular weight confirmation.
-Amino Acid Analysis:Sequence verification.
– Circular Dichroism: Secondary structure analysis available.
-Endotoxin Testing: Available for sensitive applications.
– Stability Studies: Ensuring integrity under various conditions.
Beyond LL-37: A Complete Research Partner
Apeptide (Shanghai) Co., Ltd. is more than just an LL-37 supplier. We are a full-service biochemical manufacturer committed to advancing research worldwide. ll-37 peptide for sale
 Our Capabilities
– Custom Synthesis: Develop proprietary peptides for your specific research needs.
– Catalog Peptides: Hundreds of sequences available for immediate shipment.
– Antimicrobial Peptide Library:Comprehensive collection of host defense peptides.
– Fluorescent Dyes High-purity labeling agents for imaging and detection.
– Amino Acids: Building blocks for synthesis and research.
n
The search for LL-37 peptide for sale ends at Apeptide (Shanghai) Co., Ltd. As a dedicated manufacturer of peptides and biochemicals, we combine scientific expertise with manufacturing integrity to deliver the purest research materials available. Whether you need LL-37 for antimicrobial studies, immunology research, or wound healing investigations, we are your trusted manufacturing partner.
Ready to advance your research with verified 99% purity LL-37?
Visit our website today: [https://shanghaiapeptides.com](https://shanghaiapeptides.com)

Leave a Reply

Your email address will not be published. Required fields are marked *