LL 37 Peptide for Sale | Shanghai Apeptide
Welcome to Shanghai Apeptide Co., Ltd., your definitive source for premium ll 37 peptide for sale. If you are a researcher or a supply company in the USA seeking a reliable, wholesale partner, you have found it. As an authentic, licensed manufacturer headquartered in Shanghai, China, we bridge the gap between advanced peptide synthesis and your laboratory’s precise ll 37 peptide for sale requirements.
Our foundation of quality is built at our primary physical location: No. B Room 326, Jinhai Road 2588, Pudong District, Shanghai, China. From this advanced facility, we oversee all peptide synthesis operations, ensuring that every shipment of ll 37 peptide meets our unwavering 99% purity standard. We invite you to explore our comprehensive range and discover the Apeptide difference.
Understanding the Cathelicidin Peptide
LL-37 is the only human member of the cathelicidin family of antimicrobial peptides. It is an amphipathic, alpha-helical peptide composed of 37 amino acids, with the sequence [LL-37, 37 aa] . It is cleaved from the C-terminus of the human cathelicidin protein, hCAP18, and plays a fundamental role in the innate immune system .
Scientists study LL-37 for its diverse and potent biological activities, including:
-
Broad-Spectrum Antimicrobial Activity: It directly disrupts the membranes of bacteria, fungi, and certain enveloped viruses, serving as a first line of defense against pathogens .
-
Immune Modulation: It acts as a chemoattractant for immune cells like neutrophils, monocytes, and T-cells, recruiting them to sites of infection or injury . ll 37 peptide for sale
-
Wound Healing Promotion: It stimulates angiogenesis (new blood vessel formation) and re-epithelialization, accelerating the repair of damaged skin and tissue .
-
Neutralization of Endotoxins: It binds to and neutralizes lipopolysaccharide (LPS), a potent endotoxin released from Gram-negative bacteria, thereby reducing excessive inflammation .
-
Biofilm Inhibition: Research indicates it can inhibit the formation of bacterial biofilms and disrupt existing ones, which is critical for studying chronic infections .
It is essential to state clearly: LL-37 peptide is supplied strictly for research and laboratory use only. It is not for human consumption or medical application.
The Science Behind LL-37: A Research Overview
LL-37 is a cornerstone of innate immunity research, acting as a multifunctional “host defense peptide” that directly combats pathogens while orchestrating broader immune responses .
:How Does LL-37 Work?
LL-37’s mechanisms are complex and context-dependent, reflecting its role as both an antimicrobial and an immunomodulator. Its primary research-relevant actions include:
-
Membrane Disruption (Antimicrobial Action): Its cationic (positively charged) and amphipathic structure allows it to bind to the negatively charged membranes of microbes. It then inserts into the membrane, forming pores and causing lethal leakage of cellular contents . ll 37 peptide for sale
-
Receptor-Mediated Signaling (Immunomodulation): It binds to and activates various receptors on host cells, including FPRL-1 (formyl peptide receptor-like 1) and P2X7 purinergic receptors . This triggers signaling cascades that influence cell migration, proliferation, and cytokine release.
-
Chemotaxis: Through receptor activation, it directs the migration of immune cells to sites of inflammation, linking the initial antimicrobial response to adaptive immunity .
-
Angiogenesis and Wound Healing: It directly stimulates the formation of capillary-like structures in endothelial cells and promotes the migration and proliferation of keratinocytes, accelerating wound closure in research models .
Key Research Context and Resources
-
Innate Immunity Research: LL-37 is a benchmark molecule for studying host defense peptides. Researchers can find foundational data through resources like the and , which index thousands of peer-reviewed studies on its structure, function, and role in diseases from psoriasis to chronic wounds .
-
Structural and Chemical Information: For detailed chemical and pharmacological data, provides a comprehensive entry for LL-37, including its sequence, molecular weight (4493.3 g/mol), and known targets . This body of work underscores the critical need for high-purity, reliable peptides for reproducible research.
Why Choose Shanghai Apeptide for Your Research Needs?
When your experiments depend on accuracy and consistency, your choice of supplier is paramount. Here is why leading labs choose us for ll 37 peptide supply. ll 37 peptide for sale
1. Uncompromising Quality and 99% Purity
We are the manufacturer, not a distributor. Our synthesis facility in the Pudong District of Shanghai is dedicated to producing research peptides of the highest caliber. The 37-amino acid length of LL-37 requires advanced synthesis expertise. Every batch of our ll 37 peptide is synthesized and purified to achieve 99% purity, verified by HPLC and Mass Spectrometry analysis. This guarantees your experimental data reflects the true properties of the compound, free from confounding impurities.
2. Direct Manufacturer-Direct Pricing
By sourcing directly from Shanghai Apeptide Co., Ltd., you eliminate supply chain markups. This means you acquire premium, licensed products at genuinely competitive wholesale prices. This makes us the ideal partner for both small, specialized labs and large-scale US-based supply companies.
3. Specialized Expertise in Peptide Chemistry
Our core mission is the research, development, and manufacture of biochemicals, with a deep focus on peptides, fluorescent dyes, and amino acids. This specialization ensures we understand your need for consistency, proper documentation, and technical support. Trust that your order of LL-37 for sale is handled with expert care.ll 37 peptide for sale
Committed to Global Research Standards
Our manufacturing philosophy aligns with the expectations of the international scientific community. For researchers seeking deeper insights into LL-37 and its applications, resources like the National Institutes of Health (NIH) offer extensive, peer-reviewed data via PubMed. Broader discussions on innate immunity, antimicrobial peptides, and wound healing research can also be found on professional platforms like Medium and in journals available through ScienceDirect . These resources all underscore the same principle: valid science requires high-quality, reliable materials.
For a broader view of our quality standards, explore our detailed product page on . You can also review the specifications for , another advanced research compound in our catalog.
Frequently Asked Questions About LL-37 Peptide
1: Is this LL-37 peptide for human consumption?
No. Absolutely not. Shanghai Apeptide Co., Ltd. supplies ll 37 peptide for sale strictly for research and laboratory purposes only. It is not approved or intended for human consumption, medical use, or veterinary application . ll 37 peptide for sale
2: What purity level do you guarantee for LL-37?
We specialize in Premium High Quality 99% Purity Peptides. Our LL-37 is rigorously synthesized and tested via HPLC and Mass Spectrometry to meet this high standard consistently, ensuring reliability for your sensitive research protocols.
3: What is the sequence and molecular weight of LL-37?
LL-37 has the amino acid sequence [LL-37, 37 aa] . Its molecular formula is C₁₉₈H₃₄₁N₅₉O₅₃, and its molecular weight is approximately 4493.3 g/mol .
4: What are the primary research applications for LL-37?
LL-37 is widely studied in innate immunity, antimicrobial research, wound healing, dermatology (e.g., psoriasis, rosacea), inflammatory bowel disease, and as a model for host defense peptide mechanisms .
5: Can I order LL-37 in bulk for my supply company?
Yes, we are a dedicated wholesale supplier. We welcome inquiries and orders of all sizes. Visit our shop to see our product range and contact our team for customized bulk pricing.
6: How should LL-37 peptide be stored for research?
For optimal stability, LL-37 (typically supplied as a lyophilized powder) should be stored at -20°C for long-term storage, protected from light and moisture. Short-term storage at 2-8°C is acceptable. Avoid repeated freeze-thaw cycles once reconstituted. Please refer to the Certificate of Analysis (CoA) included with your order for specific storage guidelines.
7: Are you a legitimate, licensed manufacturer based in China?
Yes. Shanghai Apeptide Co., Ltd. is a professional, authentic manufacturer. Our headquarters and peptide synthesis operations are located at No. B Room 326, Jinhai Road 2588, Pudong District, Shanghai, China. We are fully dedicated to the compliant research, development, and marketing of diverse biochemical products. ll 37 peptide for sale
Ready to Source Premium LL-37 for Your Research?
Do not compromise on the quality of your critical research materials. As a premier peptide manufacturer in China, Shanghai Apeptide is your direct, reliable source for the high-purity raw materials you need to advance discovery in immunology and host defense.
Whether you need a small quantity for a specific study or a consistent wholesale supply for your business, our team is ready to support you. Experience the confidence of working with a trusted, licensed supplier.

