Skip to content
  • Advancing science with every peptide.
  • Login
    • Contact
    • Available 24/7!
    • WhatsApp Us
  • Advancing science with every peptide.
Shanghai Advanced PeptidesShanghai Advanced Peptides
  • Home
  • Shop
  • Bulk Orders
  • Reviews
  • Shipping & Returns
  • Blog
  • FAQs
  • About Us
  • Contact Us
  • Cart / $0.00 0
    • No products in the cart.

      Return to shop

  • 0
    Cart
LL37 peptide for sale
retatrutide research peptide for sale
LL37 peptide for sale
retatrutide research peptide for sale
Home / Peptides

LL37 5mg

  • retatrutide peptide for sale
  • LC216 peptide for sale

$90.00

Looking for LL37 peptide for sale? Apeptide offers 99% pure research-grade LL-37 (5mg).

Categories: 99% High Purity Peptides, Peptides, Peptides For Sale In USA, Research Peptides Near Me Tags: alastin, alastinskincare serum, antioxidants, bodybuilding, esthetician, ghrp, hcgchica, hcgcommunity hcgresults, hcgdiet, hcgdrop, hcgfamily, hcginjections doral, hcgjourney, hcglife, hcgpellets, hcgphase, hcgplus, hcgprotocol, hcgsupport, hcgusers, hcgweightloss, hcgworks, health, hrt, hyaluronicacid, injectionshcg, lipo, lipotropic, lipotropicinjections, miami, miamibeach, peptideskincare, retinol, sarms, skincareroutine, supplements, testosterone, trihextechnology, vitaminc
  • retatrutide peptide for sale
  • LC216 peptide for sale
  • Description
  • Reviews (0)

LL37 5mg Peptide for Sale – Direct from Shanghai Manufacturer

LL-37 stands as a unique and powerful molecule in the human immune system—the only cathelicidin-derived antimicrobial peptide expressed in humans . This 37-amino acid host defense peptide plays a critical role in innate immunity, directly killing pathogens while modulating immune responses and promoting wound healing . If you are searching for “LL37 peptide for sale” for your laboratory investigations, you need a manufacturing partner who understands the complexity of this host defense peptide and can deliver the purity your studies demand. That partner is Apeptide (Shanghai) Co., Ltd. LL37 peptide for sale

We are a legitimate, licensed manufacturer operating from our headquarters at No. B Room 326, Jinhai Road 2588, Pudong District, Shanghai, China. Our facility is dedicated to the research, development, and production of high-purity peptide raw materials, catalog peptides, fluorescent dyes, and amino acids. When you purchase LL37 5mg peptide from shanghaiapeptides.com, you are buying directly from the source—not a middleman or reseller. LL37 peptide for sale


Understanding LL-37: The Human Cathelicidin

LL-37 (also known as hCAP18-derived antimicrobial peptide) is a 37-amino acid peptide that is cleaved from the C-terminal end of the human cathelicidin protein, hCAP18 . It is the sole member of the cathelicidin family expressed in humans and plays a multifaceted role in immune defense and cellular regulation . LL37 peptide for sale

Key Characteristics

Parameter Specification
Sequence [LL-37, 37 aa]
Molecular Formula C₂₀₅H₃₄₀N₆₀O₅₃
Molecular Weight Approximately 4,493.3 g/mol
CAS Number 154947-66-7
Form Lyophilized powder
Purity ≥99% (verified by HPLC)
Storage -20°C, protected from light and moisture

Structural Features

Feature Description Functional Significance
Amphipathic α-Helix Forms helical structure in membrane-mimetic environments Essential for membrane disruption
37 Amino Acids LL-37 derived from N-terminal LL residues Full-length bioactive peptide
Cationic Nature Net positive charge (+6 at neutral pH) Electrostatic attraction to bacterial membranes
C-Terminal Amidation Not amidated (free C-terminus) Distinct from many antimicrobial peptides

Why LL-37 Matters in Research

LL-37 has been extensively studied for its dual role as a direct antimicrobial agent and an immunomodulatory peptide . Unlike conventional antibiotics that simply kill bacteria, LL-37 also modulates host immune responses, making it a unique tool for investigating host-pathogen interactions. LL37 peptide for sale

Key Research Applications

Research Area Key Findings Research Context
Antimicrobial Activity Kills bacteria, fungi, viruses, and parasites via membrane disruption Infectious disease, drug resistance
Immunomodulation Chemoattractant for immune cells; modulates cytokine release Inflammation, autoimmune disease
Wound Healing Promotes angiogenesis and re-epithelialization; reduces biofilm formation Wound healing models, tissue repair
Biofilm Research Inhibits biofilm formation and disrupts established biofilms Chronic infections, medical device research
Cancer Biology Induces apoptosis in certain cancer cell lines; modulates immune response Oncology, tumor immunology
Inflammatory Diseases Dysregulated in psoriasis, rosacea, and inflammatory bowel disease Dermatology, gastroenterology
Host Defense Mechanisms Functions as alarmin; activates immune cells Innate immunity, immunology

Antimicrobial Spectrum

Microorganism Type Examples Activity
Gram-positive Bacteria S. aureus, S. pyogenes, B. subtilis Bactericidal
Gram-negative Bacteria E. coli, P. aeruginosa, S. typhimurium Bactericidal
Fungi C. albicans, C. neoformans Fungicidal
Viruses HIV, influenza, RSV Antiviral
Biofilms P. aeruginosa, S. aureus Inhibits formation, disrupts existing

The Critical Importance of Quality for LL-37 Research

When you purchase LL37 peptide for sale, quality parameters are non-negotiable. LL-37 is a 37-amino acid amphipathic peptide that requires precise synthesis to ensure correct folding and full biological activity . LL37 peptide for sale

The Apeptide Quality Standard

  • 99% Purity Guarantee: Verified by High-Performance Liquid Chromatography (HPLC)

  • Mass Spectrometry: Molecular weight confirmation (4,493.3 Da expected)

  • Amino Acid Analysis: Sequence verification of all 37 amino acids

  • Peptide Content Determination: Accurate net peptide weight (≥80% typical)

  • Counterion Analysis: Acetate or TFA content specified

  • Water Content: ≤8.0% by Karl Fischer

  • Endotoxin Testing: <0.05 EU/mg available for cell culture applications

  • Batch-Specific COAs: Full traceability with Certificates of Analysis

Why Purity Matters for LL-37 Research

  • Antimicrobial Assays: MIC values require precise dosing

  • Cell Culture Applications: Endotoxin levels affect immune cell responses

  • Biofilm Studies: Impurities can confound activity measurements

  • Immunomodulation Studies: Contaminants may activate or suppress immune cells


The Manufacturer Advantage: Why Source LL-37 from Apeptide

When you search for “LL37 peptide for sale,” you encounter many options. Here is why direct sourcing from our Shanghai facility is the superior choice.

Complete Transparency

  • Physical Location: We operate from No. B Room 326, Jinhai Road 2588, Pudong District, Shanghai. You can verify our credentials.

  • Manufacturing Expertise: Decades of combined experience in peptide synthesis and biochemical production.

  • No Middlemen: You pay manufacturer-direct pricing, not reseller markups. LL37 peptide for sale

Technical Expertise

Our team understands the specific requirements for LL-37 research:

  • Proper handling to prevent aggregation (amphipathic nature)

  • Appropriate reconstitution for antimicrobial assays

  • Storage conditions to maintain activity

  • Documentation requirements for research compliance

Quality You Can Trust

  • Rigorous Testing: Every batch undergoes HPLC and MS analysis

  • Documentation: Full COAs provided for complete traceability

  • Consistency: Reliable quality batch after batch


Seamless Supply to the USA Market

Sourcing LL37 5mg peptide from China should be straightforward. We have optimized our logistics specifically for American researchers and wholesale partners.

  • Fast Shipping: 5-7 business days to US addresses

  • Cold-Chain Packaging: Temperature-controlled transit at -20°C for sensitive peptides

  • Desiccant Protection: Double-sealed packaging to prevent moisture absorption

  • Wholesale Programs: Dedicated support for small and large supply companies

  • Customs Expertise: Smooth clearance with complete documentation

  • Tracking Integration: Real-time visibility from Shanghai to your lab


Research Applications: Where LL-37 Excels

Understanding the diverse applications of LL-37 helps researchers appreciate why quality matters. LL37 peptide for sale

Antimicrobial Research

  • Minimum Inhibitory Concentration (MIC) assays

  • Minimum Bactericidal Concentration (MBC) assays

  • Time-kill kinetics studies

  • Membrane permeability assays (SYTOX, propidium iodide)

  • Combination studies with conventional antibiotics

Biofilm Research

  • Biofilm formation inhibition assays (crystal violet)

  • Established biofilm disruption studies

  • Confocal microscopy of biofilm architecture

  • Medical device-associated infection models

Immunology Research

  • Chemotaxis assays (neutrophils, monocytes, T cells)

  • Cytokine/chemokine profiling (ELISA, multiplex)

  • Macrophage polarization studies

  • Dendritic cell activation assays

  • Toll-like receptor (TLR) signaling

Wound Healing Research

  • Scratch wound assays (in vitro)

  • Excisional wound models (in vivo)

  • Angiogenesis assays (HUVEC tube formation)

  • Re-epithelialization studies

Cancer Research

  • Cell viability assays (MTT, CCK-8)

  • Apoptosis detection (Annexin V, caspase-3)

  • Cell migration and invasion assays

  • Tumor microenvironment studies


Frequently Asked Questions

: What exactly is LL37 peptide for sale at Apeptide?
A: LL-37 is a 37-amino acid antimicrobial peptide and the only cathelicidin-derived peptide expressed in humans. It exhibits broad-spectrum antimicrobial activity and immunomodulatory functions. It is supplied strictly for laboratory investigation and in vitro research only, not for human consumption. LL37 peptide for sale

: What purity levels do you guarantee for LL-37?
A: We guarantee 99% purity, verified by HPLC testing with Certificates of Analysis available for every batch. Each COA provides detailed purity analysis, mass spectrometry confirmation (4,493.3 Da expected), and batch-specific data.

: What is the CAS number for LL-37?
A: The CAS number for LL-37 is 154947-66-7 .

: What is the molecular weight of LL-37?
A: The molecular weight is approximately 4,493.3 g/mol .

: What makes LL-37 unique among antimicrobial peptides?
A: LL-37 is the only cathelicidin-derived antimicrobial peptide expressed in humans. It has dual functions: direct antimicrobial activity via membrane disruption and immunomodulatory effects via chemotaxis and cytokine modulation . LL37 peptide for sale

: What microorganisms does LL-37 target?
A: LL-37 exhibits broad-spectrum activity against Gram-positive and Gram-negative bacteria, fungi, viruses, and parasites. It also inhibits and disrupts biofilms .

: Is your LL-37 for human consumption?
A: Absolutely not. Our LL-37 is strictly for research and laboratory use only. It is not for human consumption, clinical application, or any use involving humans or animals. All products are labeled “FOR RESEARCH USE ONLY.”

: How should I store LL-37 upon receipt?
A: LL-37 should be stored at -20°C (freezer) immediately upon receipt, protected from light and moisture. Lyophilized powder is stable when stored properly. Avoid repeated freeze-thaw cycles. To prevent aggregation, reconstitute immediately before use.

: What solvent should I use for reconstitution?
A: For most research applications, sterile water or PBS (pH 7.4) is appropriate. LL-37 is soluble in aqueous buffers. Note that LL-37 can aggregate in low-ionic-strength solutions. Contact our technical team for application-specific recommendations.

: Do you ship to all 50 US states?
A: Yes. We ship to research institutions, laboratories, and wholesale partners throughout the United States.

: Can you accommodate bulk orders for wholesale distribution?
A: Absolutely. We offer competitive wholesale pricing for qualified partners. Contact our team through shanghaiapeptides.com with your volume requirements.

: What documentation do you provide for research compliance?
A: Every order includes batch-specific Certificates of Analysis (COAs) with HPLC and MS data. We also provide commercial invoices, packing lists, and customs documentation as needed.  LL37 peptide for sale


Quality Control: The Apeptide Standard

Your research deserves nothing less than the highest purity materials. Our quality control protocols exceed industry standards.

Analytical Methods

  • HPLC Analysis: Every batch tested for purity (typically 99%+)

  • Mass Spectrometry: ESI-MS or MALDI-TOF for molecular weight confirmation (4,493.3 Da expected)

  • Amino Acid Analysis: Sequence verification of all 37 amino acids

  • Peptide Content Determination: Accurate net peptide weight (≥80% typical)

  • Counterion Analysis: Acetate or TFA content specified

  • Endotoxin Testing: <0.05 EU/mg available for cell culture applications

  • Stability Studies: Ensuring integrity under various conditions

Batch Documentation

Each shipment includes:

  • Certificate of Analysis with actual test results

  • HPLC chromatogram (available upon request)

  • Mass spectrometry data

  • Batch number for traceability

  • Expiration date and storage recommendations

  • Reconstitution guidelines


Beyond LL-37: A Complete Research Partner

Apeptide (Shanghai) Co., Ltd. is more than just a supplier of LL37 peptide for sale. We are a full-service biochemical manufacturer committed to advancing research worldwide.

Our Capabilities

  • Custom Synthesis: Develop proprietary peptides for your specific research needs

  • Catalog Peptides: Hundreds of sequences available for immediate shipment

  • Antimicrobial Peptide Library: Including defensins, cathelicidins, and synthetic analogs

  • Fluorescent Dyes: High-purity labeling agents for imaging and detection

  • Amino Acids: Building blocks for synthesis and research

Quality Certifications & Compliance

  • Licensed manufacturer with physical facility in Pudong District, Shanghai

  • Rigorous quality control protocols

  • Transparent documentation and traceability

  • Experienced technical support team

  • Strict adherence to research-use-only compliance


The Science Behind LL-37: The Human Cathelicidin

LL-37 was first identified in 1995 as the C-terminal peptide of the human cathelicidin protein hCAP18 . The name “LL-37” derives from its N-terminal leucine residues (LL) and its length of 37 amino acids .

The peptide adopts an amphipathic α-helical structure in membrane-mimetic environments, with a hydrophobic face that inserts into bacterial membranes and a hydrophilic face that interacts with the aqueous environment . This structure enables its primary antimicrobial mechanism: membrane disruption .

Beyond direct antimicrobial activity, LL-37 functions as an “alarmin” that alerts the immune system to the presence of pathogens . It acts as a chemoattractant for neutrophils, monocytes, and T cells; modulates cytokine production; and promotes wound healing and angiogenesis . LL37 peptide for sale

LL-37 levels are dysregulated in several human diseases:

  • Psoriasis: Elevated levels correlate with disease severity

  • Rosacea: LL-37 fragments trigger inflammation

  • Inflammatory Bowel Disease: Altered expression in intestinal epithelium

  • Atopic Dermatitis: Reduced levels contribute to increased infections

The multifunctional nature of LL-37 makes it a valuable research tool for studying host defense, inflammation, wound healing, and drug-resistant infections.

The search for premium “LL37 peptide for sale” ends at Apeptide (Shanghai) Co., Ltd. As a dedicated manufacturer of peptides and biochemicals, we combine scientific expertise with manufacturing integrity to deliver the purest research materials available. Whether you need LL-37 for antimicrobial research, immunology studies, wound healing investigations, or specialized host defense research, we are your trusted manufacturing partner.  LL37 peptide for sale

Reviews

There are no reviews yet.

Be the first to review “LL37 5mg” Cancel reply

Related products

AOD9604 peptide for sale

Peptides For Sale In USA

AOD9604 Peptide

$50.00 – $170.00Price range: $50.00 through $170.00
Select options
This product has multiple variants. The options may be chosen on the product page
GHRP-2 peptide for sale

99% High Purity Peptides

GHRP-2 Acetate

$30.00 – $50.00Price range: $30.00 through $50.00
Select options
This product has multiple variants. The options may be chosen on the product page
HCG peptide for sale

Peptides

HCG 10000IU

$70.00 – $125.00Price range: $70.00 through $125.00
Select options
This product has multiple variants. The options may be chosen on the product page
selank peptide for sale

99% High Purity Peptides

Selank

$60.00 – $75.00Price range: $60.00 through $75.00
Select options
This product has multiple variants. The options may be chosen on the product page
Sale!
BPC 157 TB 500 peptide blend for sale

Peptides

Adipotide Peptide

$150.00 Original price was: $150.00.$130.00Current price is: $130.00.
Add to cart
TB500 peptide for sale

99% High Purity Peptides

TB500 (Thymosin B4 Acetate)

$65.00 – $125.00Price range: $65.00 through $125.00
Select options
This product has multiple variants. The options may be chosen on the product page
HGH 191AA (Somatropin)

Peptides

HGH 191AA (Somatropin)

$50.00 – $70.00Price range: $50.00 through $70.00
Select options
This product has multiple variants. The options may be chosen on the product page
ipamorelin peptide for sale

Peptides

Ipamorelin

$38.00 – $65.00Price range: $38.00 through $65.00
Select options
This product has multiple variants. The options may be chosen on the product page

Shanghai Apeptide Co., Ltd. is a trusted global manufacturer specializing in high-purity research peptides, amino acids, and biochemical products. With advanced synthesis technology and strict quality control, we deliver 99% purity peptides for laboratories, biotech companies, and pharmaceutical research worldwide.

UseFul Links
  • Shop
  • Blog
  • About Us
  • Bulk Orders
  • FAQs
  • Reviews
  • Shipping & Returns
Recent Posts
  • BPC 157 peptide for sale
  • tirzepatide research peptide for sale
  • tirzepatide peptide for sale
  • mots-c peptide for sale
  • pt 141 peptide for sale amazon price
Contact Info
From our state-of-the-art facility in Shanghai, we provide both small and bulk peptide supply with reliable global shipping, competitive pricing, and consistent quality you can depend on. Shanghai Apeptide Co., Ltd. No. B Room 326, Jinhai Road 2588 Pudong District, Shanghai, China 📧 Email: sales@shanghaiapeptides.com 📞 Phone: +1 (781) 640-3419 🌐 Website: www.shanghaiapeptides.com
Copyright 2026 © Shanghai Advanced Peptides.! 99% Purity, Our Priority!
  • Home
  • Shop
  • Bulk Orders
  • Reviews
  • Shipping & Returns
  • Blog
  • FAQs
  • About Us
  • Contact Us
  • Login

Login

Lost your password?

WhatsApp us