VIP 10mg Peptide for Sale – Direct from Shanghai Manufacturer
VIP (Vasoactive Intestinal Peptide) is a master regulator of mammalian physiology, serving as a critical neuropeptide, neurotransmitter, and immunomodulator across multiple organ systems. This 28-amino acid peptide, first isolated from porcine duodenum, has become an indispensable research tool for scientists investigating neurobiology, immunology, gastrointestinal function, and circadian rhythms . If you are searching for “VIP peptide for sale” for your laboratory investigations, you need a manufacturing partner who understands the complexity of this multi-functional peptide and can deliver the purity your studies demand. That partner is Apeptide (Shanghai) Co., Ltd. VIP peptide for sale
We are a legitimate, licensed manufacturer operating from our headquarters at No. B Room 326, Jinhai Road 2588, Pudong District, Shanghai, China. Our facility is dedicated to the research, development, and production of high-purity peptide raw materials, catalog peptides, fluorescent dyes, and amino acids. When you purchase VIP peptide for sale from shanghaiapeptides.com, you are buying directly from the source—not a middleman or reseller. VIP peptide for sale
Understanding VIP: The Multi-Functional Neuropeptide
VIP (Vasoactive Intestinal Peptide) is a 28-amino acid neuropeptide belonging to the secretin/glucagon family of peptides . It was first discovered in 1970 for its vasodilatory properties but has since been recognized as a pleiotropic regulator with diverse functions across the body .
Key Characteristics
| Parameter | Specification |
|---|---|
| Sequence | HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂ |
| Molecular Formula | C₁₄₇H₂₃₈N₄₄O₄₂S |
| Molecular Weight | Approximately 3325.8 g/mol |
| CAS Number | 40077-57-4 |
| Receptor Targets | VPAC1, VPAC2, PAC1 (with lower affinity) |
| Form | Lyophilized powder |
| Purity | ≥99% (verified by HPLC) |
| Storage | -20°C to -80°C, protected from light and moisture |
Mechanism of Action: Multi-Receptor Signaling
VIP exerts its effects through three primary G-protein coupled receptors (GPCRs):
| Receptor | Distribution | Primary Signaling | Research Implications |
|---|---|---|---|
| VPAC1 | Lung, liver, brain, immune cells | Gαs → cAMP ↑ | Anti-inflammatory, immune modulation |
| VPAC2 | Brain, pancreas, smooth muscle | Gαs → cAMP ↑ | Circadian rhythms, smooth muscle relaxation |
| PAC1 | Brain, pituitary, adrenal | Gαs and Gαq pathways | Neuroprotection, neurodevelopment |
Core Biological Functions
| System | Function | Research Applications |
|---|---|---|
| Neurobiology | Neurotransmitter, neuroprotectant, circadian rhythm regulation | Neuroscience, neurodegeneration, sleep research |
| Immunology | Anti-inflammatory, T-cell modulation, mast cell regulation | Autoimmune disease, inflammation, allergy |
| Gastrointestinal | Smooth muscle relaxation, secretion regulation, motility | IBD, gut-brain axis, digestive disorders |
| Cardiovascular | Vasodilation, blood pressure regulation | Hypertension, vascular biology |
| Respiratory | Bronchodilation, anti-inflammatory | Asthma, COPD, pulmonary inflammation |
| Endocrine | Prolactin release, hormone regulation | Neuroendocrinology |
Why VIP Matters in Research
VIP has emerged as a critical research tool across multiple domains due to its pleiotropic actions and central role in regulating inflammation, neuroprotection, and circadian biology .
Key Research Applications
| Research Area | Key Findings | Research Context |
|---|---|---|
| Neuroprotection & Neurodegeneration | Protects neurons against excitotoxicity and oxidative stress; promotes neuronal survival; modulates synaptic plasticity; VIP knockout mice show altered circadian rhythms and memory deficits | Alzheimer’s disease, Parkinson’s disease, stroke, traumatic brain injury |
| Autoimmune & Inflammatory Diseases | Suppresses Th17 differentiation; promotes regulatory T-cell (Treg) differentiation; reduces TNF-α, IL-6, and IL-17 production; ameliorates disease severity in arthritis, colitis, and multiple sclerosis models | Rheumatoid arthritis, inflammatory bowel disease, multiple sclerosis, uveitis |
| Circadian Rhythm Research | Critical regulator of the suprachiasmatic nucleus (SCN); synchronizes circadian clocks; VIP-VPAC2 signaling essential for rhythmicity | Chronobiology, sleep disorders, jet lag, shift work disorders |
| Gastrointestinal Research | Regulates intestinal motility and secretion; protective in colitis models; modulates gut barrier function | Inflammatory bowel disease, irritable bowel syndrome, gut barrier function |
| Respiratory Research | Potent bronchodilator; anti-inflammatory in lung tissue; reduces airway hyperresponsiveness | Asthma, COPD, pulmonary fibrosis |
| Cancer Research | Proliferative vs. anti-proliferative effects depending on context; receptor expression correlates with prognosis | Neuroendocrine tumors, breast cancer, pancreatic cancer |
VIP Knockout Phenotypes: Insights for Research
| Phenotype | Research Significance |
|---|---|
| Reduced survival in inflammatory disease models | Demonstrates VIP’s essential role in immune regulation |
| Altered circadian rhythms and sleep patterns | Confirms VIP’s role as master circadian regulator |
| Impaired intestinal motility | Highlights VIP’s role in gastrointestinal function |
| Increased susceptibility to neurotoxicity | Suggests neuroprotective functions |
The Critical Importance of Quality for VIP Research
When you purchase VIP peptide for sale, quality parameters are non-negotiable. VIP is a 28-amino acid peptide with a C-terminal amide critical for receptor binding and bioactivity .
The Apeptide Quality Standard
-
99% Purity Guarantee: Verified by High-Performance Liquid Chromatography (HPLC)
-
Mass Spectrometry: Molecular weight confirmation (3325.8 Da expected)
-
Amino Acid Analysis: Sequence verification of all 28 amino acids
-
Peptide Content Determination: Accurate net peptide weight (≥80% typical)
-
C-Terminal Amidation Confirmation: Essential for biological activity
-
Counterion Analysis: Acetate or TFA content specified
-
Water Content: ≤8.0% by Karl Fischer
-
Endotoxin Testing: <0.05 EU/mg available for cell culture applications
-
Batch-Specific COAs: Full traceability with Certificates of Analysis
-
Stability Testing: Ensuring integrity from our lab to yours
Why Purity Matters for VIP Research
-
Receptor Binding Studies: EC₅₀ values in low nanomolar range require precise dosing
-
In Vivo Studies: Dosing consistency critical for longitudinal studies
-
Cell Culture Applications: Endotoxin levels affect immune cell responses
-
Mechanistic Studies: Pathway analysis demands documented purity
-
Circadian Studies: Consistent material essential for rhythm studies
The Manufacturer Advantage: Why Source VIP from Apeptide
When you search for “VIP peptide for sale,” you encounter many options. Here is why direct sourcing from our Shanghai facility is the superior choice. VIP peptide for sale
Complete Transparency
-
Physical Location: We operate from No. B Room 326, Jinhai Road 2588, Pudong District, Shanghai. You can verify our credentials.
-
Manufacturing Expertise: Decades of combined experience in peptide synthesis and biochemical production.
-
No Middlemen: You pay manufacturer-direct pricing, not reseller markups.
Technical Expertise
Our team understands the specific requirements for VIP research:
-
Importance of C-terminal amidation for receptor binding
-
Proper handling to maintain peptide stability (VIP can be susceptible to degradation)
-
Appropriate reconstitution for various assay systems
-
Storage conditions to prevent degradation (VIP stable for years at -80°C)
-
Documentation requirements for research compliance
Quality You Can Trust
-
Rigorous Testing: Every batch undergoes HPLC and MS analysis
-
Documentation: Full COAs provided for complete traceability
-
Consistency: Reliable quality batch after batch
Seamless Supply to the USA Market
Sourcing VIP peptide for sale from China should be straightforward. We have optimized our logistics specifically for American researchers and wholesale partners.
-
Fast Shipping: 5-7 business days to US addresses
-
Cold-Chain Packaging: Temperature-controlled transit at -20°C or -80°C for sensitive peptides
-
Desiccant Protection: Double-sealed packaging to prevent moisture absorption
-
Wholesale Programs: Dedicated support for small and large supply companies
-
Customs Expertise: Smooth clearance with complete documentation
-
Tracking Integration: Real-time visibility from Shanghai to your lab
Research Applications: Where VIP Excels
Understanding the diverse applications of VIP helps researchers appreciate why quality matters.
Neurobiology & Circadian Research
-
Suprachiasmatic nucleus (SCN) slice cultures
-
Circadian rhythm entrainment studies
-
Neuronal survival and neuroprotection assays
-
Synaptic plasticity investigations
-
Neurodegenerative disease models
Immunology & Inflammation Research
-
T-cell differentiation (Th17 vs. Treg) studies
-
Macrophage polarization assays
-
Cytokine profiling (TNF-α, IL-6, IL-17, IL-10)
-
Autoimmune disease models (EAE, colitis, arthritis)
-
Mast cell regulation and degranulation studies
Gastrointestinal Research
-
Intestinal motility assays
-
Colitis models (DSS, TNBS)
-
Gut barrier function studies
-
Enteric nervous system investigations
-
Secretion and absorption studies
Respiratory Research
-
Airway smooth muscle relaxation assays
-
Bronchoconstriction models
-
Pulmonary inflammation studies
-
Asthma and COPD models
Cardiovascular Research
-
Vasodilation and blood pressure studies
-
Endothelial function assays
-
Ischemia-reperfusion models
Frequently Asked Questions
: What exactly is VIP peptide for sale at Apeptide?
A: VIP (Vasoactive Intestinal Peptide) is a 28-amino acid neuropeptide belonging to the secretin/glucagon family. It acts as a neurotransmitter, neuromodulator, and immunoregulator with diverse functions across the nervous, immune, and gastrointestinal systems. It is supplied strictly for laboratory investigation and in vitro research only, not for human consumption. VIP peptide for sale
: What purity levels do you guarantee for VIP?
A: We guarantee 99% purity, verified by HPLC testing with Certificates of Analysis available for every batch. Each COA provides detailed purity analysis, mass spectrometry confirmation (3325.8 Da expected), and batch-specific data.
: What is the CAS number for VIP?
A: The CAS number for VIP (human, porcine, rat) is 40077-57-4 .
: What is the molecular weight of VIP?
A: The molecular weight is approximately 3325.8 g/mol .
: What receptors does VIP bind to?
A: VIP binds primarily to VPAC1 and VPAC2 receptors, with lower affinity for PAC1 receptors. These are G-protein coupled receptors that activate adenylate cyclase and increase cAMP .
: What are the primary research applications for VIP?
A: VIP is used in neuroscience (neuroprotection, circadian rhythms), immunology (anti-inflammatory, T-cell modulation), gastrointestinal research (motility, IBD models), and respiratory research (bronchodilation, asthma models) .
: Is your VIP for human consumption?
A: Absolutely not. Our VIP is strictly for research and laboratory use only. It is not for human consumption, clinical application, or any use involving humans or animals. All products are labeled “FOR RESEARCH USE ONLY.” VIP peptide for sale
: How should I store VIP upon receipt?
A: VIP should be stored at -20°C to -80°C (freezer) immediately upon receipt, protected from light and moisture. For long-term storage, -80°C is recommended. Avoid repeated freeze-thaw cycles. Lyophilized VIP is stable for years when stored properly.
: What solvent should I use for reconstitution?
A: For most research applications, sterile water or PBS (pH 7.4) is appropriate. VIP is soluble in aqueous buffers. Contact our technical team for application-specific recommendations.
: Do you ship to all 50 US states?
A: Yes. We ship to research institutions, laboratories, and wholesale partners throughout the United States.
: Can you accommodate bulk orders for wholesale distribution?
A: Absolutely. We offer competitive wholesale pricing for qualified partners. Contact our team through shanghaiapeptides.com with your volume requirements.
: What documentation do you provide for research compliance?
A: Every order includes batch-specific Certificates of Analysis (COAs) with HPLC and MS data. We also provide commercial invoices, packing lists, and customs documentation as needed.
Quality Control: The Apeptide Standard
Your research deserves nothing less than the highest purity materials. Our quality control protocols exceed industry standards. VIP peptide for sale
Analytical Methods
-
HPLC Analysis: Every batch tested for purity (typically 99%+)
-
Mass Spectrometry: ESI-MS or MALDI-TOF for molecular weight confirmation (3325.8 Da expected)
-
Amino Acid Analysis: Sequence verification of all 28 amino acids
-
C-Terminal Amidation Confirmation: Essential for biological activity
-
Peptide Content Determination: Accurate net peptide weight (≥80% typical)
-
Counterion Analysis: Acetate or TFA content specified
-
Water Content: ≤8.0% by Karl Fischer
-
Endotoxin Testing: <0.05 EU/mg available for cell culture applications
-
Stability Studies: Ensuring integrity under various conditions
Batch Documentation
Each shipment includes:
-
Certificate of Analysis with actual test results
-
HPLC chromatogram (available upon request)
-
Mass spectrometry data
-
Batch number for traceability
-
Expiration date and storage recommendations
-
Reconstitution guidelines
Beyond VIP: A Complete Research Partner
Apeptide (Shanghai) Co., Ltd. is more than just a supplier of VIP peptide for sale. We are a full-service biochemical manufacturer committed to advancing research worldwide.
Our Capabilities
-
Custom Synthesis: Develop proprietary peptides for your specific research needs
-
Catalog Peptides: Hundreds of sequences available for immediate shipment
-
Neuropeptide Library: Including VIP, PACAP, secretin, glucagon, and related peptides
-
Fluorescent Dyes: High-purity labeling agents for imaging and detection
-
Amino Acids: Building blocks for synthesis and research
Quality Certifications & Compliance
-
Licensed manufacturer with physical facility in Pudong District, Shanghai
-
Rigorous quality control protocols
-
Transparent documentation and traceability
-
Experienced technical support team
-
Strict adherence to research-use-only compliance
The Science Behind VIP: A Master Regulator of Mammalian Physiology
VIP was first isolated from porcine duodenum in 1970 by Said and Mutt, who identified its potent vasodilatory properties . Subsequent research revealed that VIP is a member of the secretin/glucagon family of peptides, sharing structural homology with PACAP, secretin, and glucagon .
VIP is widely distributed throughout the body, with high concentrations in the central and peripheral nervous systems, gastrointestinal tract, and immune cells . Its actions are mediated primarily through two G-protein coupled receptors, VPAC1 and VPAC2, which activate adenylate cyclase and increase intracellular cAMP .
In the suprachiasmatic nucleus (SCN)—the master circadian clock—VIP is a critical signaling molecule that synchronizes individual neurons and maintains coherent rhythms . VIP-VPAC2 signaling is essential for circadian rhythmicity; mice lacking VIP or VPAC2 exhibit disrupted circadian behavior and are arrhythmic in constant darkness .
In the immune system, VIP is a potent anti-inflammatory mediator that suppresses pro-inflammatory cytokine production (TNF-α, IL-6, IL-17) while promoting regulatory T-cell differentiation . This has made VIP a valuable research tool for studying autoimmune and inflammatory diseases . VIP peptide for sale
In the gastrointestinal tract, VIP regulates smooth muscle relaxation, intestinal motility, and fluid secretion . It is also a potent bronchodilator and anti-inflammatory agent in the respiratory system .
The pleiotropic nature of VIP—acting as a neurotransmitter, immunomodulator, and endocrine regulator—makes it one of the most versatile research tools in biomedical science .
The search for premium “VIP peptide for sale” ends at Apeptide (Shanghai) Co., Ltd. As a dedicated manufacturer of peptides and biochemicals, we combine scientific expertise with manufacturing integrity to deliver the purest research materials available. Whether you need VIP for neuroscience research, immunology studies, circadian rhythm investigations, or specialized applications, we are your trusted manufacturing partner. VIP peptide for sale














Reviews
There are no reviews yet.